PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009149464.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family SRS
Protein Properties Length: 346aa    MW: 37881.2 Da    PI: 6.6682
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009149464.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702226.54.9e-701152742154
          DUF702   2 rsgtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasa.......aeaaskrkrel....kskkqsa 85 
                     r+g+++CqdCGnqakkdC h+RCRtCCksrgfdC+thvkstWvpaakrrerq+qla + +k++++a       +    +r+ ++         sa
  XP_009149464.1 115 RQGSMNCQDCGNQAKKDCPHMRCRTCCKSRGFDCQTHVKSTWVPAAKRRERQAQLAGLPTKRSREAssgggddD---DEREGDEngaqGGGGGSA 206
                     7899****************************************************999888887766775432...222222233334566789 PP

          DUF702  86 lsstklssaeskkeletsslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGlee 154
                     l++ ++++a+s+  +e s+lP+e+s +avfrc+rvss+dd++ee+aYqtav+igGhvfkGiLydqG+++
  XP_009149464.1 207 LACIRVVNASSS-GFESSHLPPELSLPAVFRCMRVSSIDDEDEEYAYQTAVNIGGHVFKGILYDQGPSD 274
                     999999999765.99***************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051421.1E-63118273IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016231.1E-27120162IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016249.9E-26224272IPR006511Lateral Root Primordium type 1, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009299Biological ProcessmRNA transcription
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 346 aa     Download sequence    Send to blast
MAGLFYLGGR ENNKQDHHHQ DKDHNEDRSN NYLHLYKDEI YNNNKGFEIW PPQYFQQQQE  60
QQNHVAPPTN FYSFGMVPSG SSHNNNRSSN RSLYFNVVSD HEPVRSSTGR FTVTRQGSMN  120
CQDCGNQAKK DCPHMRCRTC CKSRGFDCQT HVKSTWVPAA KRRERQAQLA GLPTKRSREA  180
SSGGGDDDDE REGDENGAQG GGGGSALACI RVVNASSSGF ESSHLPPELS LPAVFRCMRV  240
SSIDDEDEEY AYQTAVNIGG HVFKGILYDQ GPSDDHRYSS SPAAIAAETS QHHLNLLASA  300
SSVATTTGVT ASNINNASID PSSVYTAAPI NSFVTAATSF FASPRS
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bra.315940.0bud
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00152DAPTransfer from AT1G19790Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGU2052680.0GU205268.1 Brassica rapa subsp. pekinensis short internode related sequence 7 (SRS7) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009149465.10.0PREDICTED: protein SHI RELATED SEQUENCE 7
RefseqXP_009149464.10.0PREDICTED: protein SHI RELATED SEQUENCE 7
SwissprotQ9FXH70.0SRS7_ARATH; Protein SHI RELATED SEQUENCE 7
TrEMBLD2KC770.0D2KC77_BRARP; Short internode related sequence 7
STRINGBra025768.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM26452572
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19790.21e-152SHI-related sequence 7